Skip to content
  • Categories
  • Recent
  • Tags
  • Popular
  • World
  • Users
  • Groups
Skins
  • Light
  • Cerulean
  • Cosmo
  • Flatly
  • Journal
  • Litera
  • Lumen
  • Lux
  • Materia
  • Minty
  • Morph
  • Pulse
  • Sandstone
  • Simplex
  • Sketchy
  • Spacelab
  • United
  • Yeti
  • Zephyr
  • Dark
  • Cyborg
  • Darkly
  • Quartz
  • Slate
  • Solar
  • Superhero
  • Vapor

  • Default (No Skin)
  • No Skin
Collapse
Code Project
  1. Home
  2. The Lounge
  3. Password De-Complexity

Password De-Complexity

Scheduled Pinned Locked Moved The Lounge
algorithmsquestion
88 Posts 29 Posters 9 Views 1 Watching
  • Oldest to Newest
  • Newest to Oldest
  • Most Votes
Reply
  • Reply as topic
Log in to reply
This topic has been deleted. Only users with topic management privileges can see it.
  • Z ZurdoDev

    raddevus wrote:

    There are only more of them than there are stars in the universe so it's easy

    Ya, I needed a challenge after I counted all the stars. :^)

    There are only 10 types of people in the world, those who understand binary and those who don't.

    raddevusR Offline
    raddevusR Offline
    raddevus
    wrote on last edited by
    #25

    RyanDev wrote:

    Ya, I needed a challenge after I counted all the stars

    :laugh:

    My book, Launch Your Android App, is available at Amazon.com (only $2.99USD over 350 pages). Get my Android app on Google Play and F*orget All Your Passwords.

    1 Reply Last reply
    0
    • Z ZurdoDev

      I've noticed with several sites I have an account with that they no longer allow special characters in passwords. That seems like a move in the wrong direction. Special characters allow passwords to be more complex so I wonder why some are making this change. Has anyone else noticed this?

      There are only 10 types of people in the world, those who understand binary and those who don't.

      S Offline
      S Offline
      Slacker007
      wrote on last edited by
      #26

      All my passwords are based on a special secret alphabet that I crafted in my voodoo laboratory. Just saying...

      1 Reply Last reply
      0
      • Z ZurdoDev

        I've noticed with several sites I have an account with that they no longer allow special characters in passwords. That seems like a move in the wrong direction. Special characters allow passwords to be more complex so I wonder why some are making this change. Has anyone else noticed this?

        There are only 10 types of people in the world, those who understand binary and those who don't.

        J Offline
        J Offline
        Jochen Arndt
        wrote on last edited by
        #27

        Just a few weeks ago a new password was rejected because it contained a - (hex 2D). Using an underscore was OK. So, yes I noticed it (and thought WTF). Maybe the passwords has to be piped between shell commands, then passed as shell command parameters, HTML/XML encoded and decoded, and finally passed to a SQL query. To avoid escaping all the processing specific reserved characters using processing specific escaping it is just simpler to disallow them.

        D F 2 Replies Last reply
        0
        • D den2k88

          Cool, and exactly how one does remember that password? On a device, which may be unavailable at any time? Oh right, you can put it on the "cloud", and how do you protect the access to that account? Basically a slighlty altered and less reliable folded paper with passwords in the wallet.

          DURA LEX, SED LEX GCS d--- s-/++ a- C++++ U+++ P- L- E-- W++ N++ o+ K- w+++ O? M-- V? PS+ PE- Y+ PGP t++ 5? X R++ tv-- b+ DI+++ D++ G e++>+++ h--- ++>+++ y+++*      Weapons extension: ma- k++ F+2 X If you think 'goto' is evil, try writing an Assembly program without JMP. -- TNCaver When I was six, there were no ones and zeroes - only zeroes. And not all of them worked. -- Ravi Bhavnani

          raddevusR Offline
          raddevusR Offline
          raddevus
          wrote on last edited by
          #28

          No, there is no cloud with C'Ya Pass. Here's how it works. 1. You add unique site/keys to the app. That is a text-based string that will help you remember what the password is associated with. The app hashes that value. 2. You draw a pattern in the grid. The original hash is salted with the generated value from the grid of the pattern that you drew. Now, each time you select your site/key and draw your exact pattern then the unique hash is generated. Your passwords are not stored anywhere. This is the paradigm shift. They are generated every time you select the site/key and draw the pattern. Your password is cryptographically strong since it is a SHA256 hash. Plus it is long (64 chars) and just random chars and numbers. Thanks for asking.

          My book, Launch Your Android App, is available at Amazon.com (only $2.99USD over 350 pages). Get my Android app on Google Play and F*orget All Your Passwords.

          D 1 Reply Last reply
          0
          • raddevusR raddevus

            No, there is no cloud with C'Ya Pass. Here's how it works. 1. You add unique site/keys to the app. That is a text-based string that will help you remember what the password is associated with. The app hashes that value. 2. You draw a pattern in the grid. The original hash is salted with the generated value from the grid of the pattern that you drew. Now, each time you select your site/key and draw your exact pattern then the unique hash is generated. Your passwords are not stored anywhere. This is the paradigm shift. They are generated every time you select the site/key and draw the pattern. Your password is cryptographically strong since it is a SHA256 hash. Plus it is long (64 chars) and just random chars and numbers. Thanks for asking.

            My book, Launch Your Android App, is available at Amazon.com (only $2.99USD over 350 pages). Get my Android app on Google Play and F*orget All Your Passwords.

            D Offline
            D Offline
            den2k88
            wrote on last edited by
            #29

            So it is a pattern to be drawn each time, this is fairly cool. It still requires a device with that app, which may be unavailable (ever been mugged? Or with a phone TFU?). A good 10-14 password unique to the site is more than enough. Usually my only problem is remembering if I registered as den2k or den2k88 (many site don't accept user names with less than 6 characters).

            DURA LEX, SED LEX GCS d--- s-/++ a- C++++ U+++ P- L- E-- W++ N++ o+ K- w+++ O? M-- V? PS+ PE- Y+ PGP t++ 5? X R++ tv-- b+ DI+++ D++ G e++>+++ h--- ++>+++ y+++*      Weapons extension: ma- k++ F+2 X If you think 'goto' is evil, try writing an Assembly program without JMP. -- TNCaver When I was six, there were no ones and zeroes - only zeroes. And not all of them worked. -- Ravi Bhavnani

            raddevusR F 2 Replies Last reply
            0
            • Z ZurdoDev

              raddevus wrote:

              There are only more of them than there are stars in the universe so it's easy

              Ya, I needed a challenge after I counted all the stars. :^)

              There are only 10 types of people in the world, those who understand binary and those who don't.

              enhzflepE Offline
              enhzflepE Offline
              enhzflep
              wrote on last edited by
              #30

              :laugh: Dont s'pose you changed your surname by deed-poll at marriage and that your wife has a father-in-law called Chuck, does she?

              1 Reply Last reply
              0
              • J Jochen Arndt

                Just a few weeks ago a new password was rejected because it contained a - (hex 2D). Using an underscore was OK. So, yes I noticed it (and thought WTF). Maybe the passwords has to be piped between shell commands, then passed as shell command parameters, HTML/XML encoded and decoded, and finally passed to a SQL query. To avoid escaping all the processing specific reserved characters using processing specific escaping it is just simpler to disallow them.

                D Offline
                D Offline
                den2k88
                wrote on last edited by
                #31

                You forgot the "signed in triplicate, sent in, sent back, queried, lost, found, subjected to public inquiry, lost again, and finally buried in soft peat for three months and recycled as firelighters" part. Sadly many sites are "managed" just like that.

                DURA LEX, SED LEX GCS d--- s-/++ a- C++++ U+++ P- L- E-- W++ N++ o+ K- w+++ O? M-- V? PS+ PE- Y+ PGP t++ 5? X R++ tv-- b+ DI+++ D++ G e++>+++ h--- ++>+++ y+++*      Weapons extension: ma- k++ F+2 X If you think 'goto' is evil, try writing an Assembly program without JMP. -- TNCaver When I was six, there were no ones and zeroes - only zeroes. And not all of them worked. -- Ravi Bhavnani

                F 1 Reply Last reply
                0
                • D den2k88

                  So it is a pattern to be drawn each time, this is fairly cool. It still requires a device with that app, which may be unavailable (ever been mugged? Or with a phone TFU?). A good 10-14 password unique to the site is more than enough. Usually my only problem is remembering if I registered as den2k or den2k88 (many site don't accept user names with less than 6 characters).

                  DURA LEX, SED LEX GCS d--- s-/++ a- C++++ U+++ P- L- E-- W++ N++ o+ K- w+++ O? M-- V? PS+ PE- Y+ PGP t++ 5? X R++ tv-- b+ DI+++ D++ G e++>+++ h--- ++>+++ y+++*      Weapons extension: ma- k++ F+2 X If you think 'goto' is evil, try writing an Assembly program without JMP. -- TNCaver When I was six, there were no ones and zeroes - only zeroes. And not all of them worked. -- Ravi Bhavnani

                  raddevusR Offline
                  raddevusR Offline
                  raddevus
                  wrote on last edited by
                  #32

                  den2k88 wrote:

                  It still requires a device with that app, which may be unavailable

                  That is correct. I have it available on Windows and Android and coming soon (within a week) to iOS (iphone/ipad). Also, there is another compelling part to all of this. I've created a bluetooth device that you attach to your computer's (works on Apple, Windows and Linux) USB port. That device has a bluetooth module that you can pair with your phone, device, etc. Then, you can have the app just on your phone and press a button in C'Ya Pass app and it will type the password on your computer. I use it every day and it is so much fun. It allows you to login to the windows login from your phone or device. You can read about the initial project here at CP: Ending the Era of Weak Passwords: Never Type A Password Again (Never Memorize A Password Again)[^] It won 2nd prize in the IoT contest. :) Thanks again for asking.

                  My book, Launch Your Android App, is available at Amazon.com (only $2.99USD over 350 pages). Get my Android app on Google Play and F*orget All Your Passwords.

                  D F P 3 Replies Last reply
                  0
                  • Z ZurdoDev

                    I've noticed with several sites I have an account with that they no longer allow special characters in passwords. That seems like a move in the wrong direction. Special characters allow passwords to be more complex so I wonder why some are making this change. Has anyone else noticed this?

                    There are only 10 types of people in the world, those who understand binary and those who don't.

                    N Offline
                    N Offline
                    Nish Nishant
                    wrote on last edited by
                    #33

                    It's easier to crack a$&12Gc# than to crack donalduckwasmyfavcharacterasakidinnewyork.

                    Regards, Nish


                    Website: www.voidnish.com Blog: voidnish.wordpress.com

                    Z 1 Reply Last reply
                    0
                    • L Lost User

                      in that case there still is EBCDIC[^].

                      The language is JavaScript. that of Mordor, which I will not utter here
                      This is Javascript. If you put big wheels and a racing stripe on a golf cart, it's still a fucking golf cart.
                      "I don't know, extraterrestrial?" "You mean like from space?" "No, from Canada." If software development were a circus, we would all be the clowns.

                      M Offline
                      M Offline
                      megaadam
                      wrote on last edited by
                      #34

                      My signature never felt better! EBCDIC[^]

                      ... such stuff as dreams are made on

                      1 Reply Last reply
                      0
                      • N Nish Nishant

                        It's easier to crack a$&12Gc# than to crack donalduckwasmyfavcharacterasakidinnewyork.

                        Regards, Nish


                        Website: www.voidnish.com Blog: voidnish.wordpress.com

                        Z Offline
                        Z Offline
                        ZurdoDev
                        wrote on last edited by
                        #35

                        Nish Nishant wrote:

                        It's easier to crack donalduckwasmyfavcharacterasakidinnewyork than to crack donalduckwasmyfavcharacterasakidinnewyork!.

                        FTFY ;)

                        There are only 10 types of people in the world, those who understand binary and those who don't.

                        N 1 Reply Last reply
                        0
                        • D den2k88

                          So it is a pattern to be drawn each time, this is fairly cool. It still requires a device with that app, which may be unavailable (ever been mugged? Or with a phone TFU?). A good 10-14 password unique to the site is more than enough. Usually my only problem is remembering if I registered as den2k or den2k88 (many site don't accept user names with less than 6 characters).

                          DURA LEX, SED LEX GCS d--- s-/++ a- C++++ U+++ P- L- E-- W++ N++ o+ K- w+++ O? M-- V? PS+ PE- Y+ PGP t++ 5? X R++ tv-- b+ DI+++ D++ G e++>+++ h--- ++>+++ y+++*      Weapons extension: ma- k++ F+2 X If you think 'goto' is evil, try writing an Assembly program without JMP. -- TNCaver When I was six, there were no ones and zeroes - only zeroes. And not all of them worked. -- Ravi Bhavnani

                          F Offline
                          F Offline
                          Foothill
                          wrote on last edited by
                          #36

                          No security system is absolute. His password app is still vulnerable to actual theft but I have to say that it would protect you against the hordes of bot-nets working tirelessly to crack user accounts all across the net.

                          if (Object.DividedByZero == true) { Universe.Implode(); } Meus ratio ex fortis machina. Simplicitatis de formae ac munus. -Foothill, 2016

                          D 1 Reply Last reply
                          0
                          • Z ZurdoDev

                            Nish Nishant wrote:

                            It's easier to crack donalduckwasmyfavcharacterasakidinnewyork than to crack donalduckwasmyfavcharacterasakidinnewyork!.

                            FTFY ;)

                            There are only 10 types of people in the world, those who understand binary and those who don't.

                            N Offline
                            N Offline
                            Nish Nishant
                            wrote on last edited by
                            #37

                            Yeah but a day's difference won't affect something that'd take weeks or months of computational power :-)

                            Regards, Nish


                            Website: www.voidnish.com Blog: voidnish.wordpress.com

                            Z 1 Reply Last reply
                            0
                            • raddevusR raddevus

                              den2k88 wrote:

                              It still requires a device with that app, which may be unavailable

                              That is correct. I have it available on Windows and Android and coming soon (within a week) to iOS (iphone/ipad). Also, there is another compelling part to all of this. I've created a bluetooth device that you attach to your computer's (works on Apple, Windows and Linux) USB port. That device has a bluetooth module that you can pair with your phone, device, etc. Then, you can have the app just on your phone and press a button in C'Ya Pass app and it will type the password on your computer. I use it every day and it is so much fun. It allows you to login to the windows login from your phone or device. You can read about the initial project here at CP: Ending the Era of Weak Passwords: Never Type A Password Again (Never Memorize A Password Again)[^] It won 2nd prize in the IoT contest. :) Thanks again for asking.

                              My book, Launch Your Android App, is available at Amazon.com (only $2.99USD over 350 pages). Get my Android app on Google Play and F*orget All Your Passwords.

                              D Offline
                              D Offline
                              den2k88
                              wrote on last edited by
                              #38

                              My main problem is that if you have to access to an account but not have a smart-thing with you or the USB thingie (which I suppose must be installed and that may be not possible if roaming or with another's machine) you are by all accouts locked out. Goodbye access to you banking site / e-mail while at work if the smartphone is unavailable due to hardware failure / in the pocket of a less-than-honest person. Especially if you work on the move, as a guest in many different companies (think of industrial equipment maintenance). The only device I rely on is my head since if it fails or is missing from the rest of the body it is evident that I have more pressing problems on my hands than a password. Also remembering a pattern isn't that easy, after months you may very easily forget which is the starting coordinate and how long is the pattern, even for a single line. It still relies on brains, plus a device. Cut the dependecies and use only the brain, it's easier and allows access under any condition which isn't physically incapacitating to the individual.

                              DURA LEX, SED LEX GCS d--- s-/++ a- C++++ U+++ P- L- E-- W++ N++ o+ K- w+++ O? M-- V? PS+ PE- Y+ PGP t++ 5? X R++ tv-- b+ DI+++ D++ G e++>+++ h--- ++>+++ y+++*      Weapons extension: ma- k++ F+2 X If you think 'goto' is evil, try writing an Assembly program without JMP. -- TNCaver When I was six, there were no ones and zeroes - only zeroes. And not all of them worked. -- Ravi Bhavnani

                              raddevusR 1 Reply Last reply
                              0
                              • J Jochen Arndt

                                Just a few weeks ago a new password was rejected because it contained a - (hex 2D). Using an underscore was OK. So, yes I noticed it (and thought WTF). Maybe the passwords has to be piped between shell commands, then passed as shell command parameters, HTML/XML encoded and decoded, and finally passed to a SQL query. To avoid escaping all the processing specific reserved characters using processing specific escaping it is just simpler to disallow them.

                                F Offline
                                F Offline
                                Foothill
                                wrote on last edited by
                                #39

                                If their website cannot handle unicode passwords, they certainly deserve to have their computer nerd card revoked.

                                if (Object.DividedByZero == true) { Universe.Implode(); } Meus ratio ex fortis machina. Simplicitatis de formae ac munus. -Foothill, 2016

                                1 Reply Last reply
                                0
                                • N Nish Nishant

                                  Yeah but a day's difference won't affect something that'd take weeks or months of computational power :-)

                                  Regards, Nish


                                  Website: www.voidnish.com Blog: voidnish.wordpress.com

                                  Z Offline
                                  Z Offline
                                  ZurdoDev
                                  wrote on last edited by
                                  #40

                                  In that case, "It's as easy to crack a$&12Gc# as abd12Gc4", so why prevent special characters?

                                  There are only 10 types of people in the world, those who understand binary and those who don't.

                                  N 1 Reply Last reply
                                  0
                                  • N Nish Nishant

                                    I guess they are trying to encourage people to use passwords that are hard to crack but easy to remember, so they don't write it down on a piece of paper and stick it on their screens. I am not siding with that idea, and would personally not enforce this rule at my work place. Just trying to guess what their thinking was.

                                    Regards, Nish


                                    Website: www.voidnish.com Blog: voidnish.wordpress.com

                                    Z Offline
                                    Z Offline
                                    ZurdoDev
                                    wrote on last edited by
                                    #41

                                    Possibly.

                                    There are only 10 types of people in the world, those who understand binary and those who don't.

                                    1 Reply Last reply
                                    0
                                    • Z ZurdoDev

                                      In that case, "It's as easy to crack a$&12Gc# as abd12Gc4", so why prevent special characters?

                                      There are only 10 types of people in the world, those who understand binary and those who don't.

                                      N Offline
                                      N Offline
                                      Nish Nishant
                                      wrote on last edited by
                                      #42

                                      I guess they are trying to encourage people to use passwords that are hard to crack but easy to remember, so they don't write it down on a piece of paper and stick it on their screens. I am not siding with that idea, and would personally not enforce this rule at my work place. Just trying to guess what their thinking was.

                                      Regards, Nish


                                      Website: www.voidnish.com Blog: voidnish.wordpress.com

                                      Z Richard DeemingR L 3 Replies Last reply
                                      0
                                      • F Foothill

                                        No security system is absolute. His password app is still vulnerable to actual theft but I have to say that it would protect you against the hordes of bot-nets working tirelessly to crack user accounts all across the net.

                                        if (Object.DividedByZero == true) { Universe.Implode(); } Meus ratio ex fortis machina. Simplicitatis de formae ac munus. -Foothill, 2016

                                        D Offline
                                        D Offline
                                        den2k88
                                        wrote on last edited by
                                        #43

                                        Yes it is safe and botnets are now the most used method for bruteforcing. The problem is that the password itself may become unavailable to the user. With a username/password you only need a terminal, access to the service and the physical capabiltiy of inputting the credentials. With the app you need aother gizmo which may be broken or elsewhere. Not everyone uses only a couple of devices of which he's the owner - when I'm in industrial plants and have to access my e-mail to download a package with the latest fix of the software (as in built fro my phone call 30 minutes before) and the gizmo with the app isn't serviceable for whatever reason I'm elephanted.

                                        DURA LEX, SED LEX GCS d--- s-/++ a- C++++ U+++ P- L- E-- W++ N++ o+ K- w+++ O? M-- V? PS+ PE- Y+ PGP t++ 5? X R++ tv-- b+ DI+++ D++ G e++>+++ h--- ++>+++ y+++*      Weapons extension: ma- k++ F+2 X If you think 'goto' is evil, try writing an Assembly program without JMP. -- TNCaver When I was six, there were no ones and zeroes - only zeroes. And not all of them worked. -- Ravi Bhavnani

                                        F 1 Reply Last reply
                                        0
                                        • W W Balboos GHB

                                          OriginalGriff wrote:

                                          won't allow a hyphen in an email address... :sigh:

                                          That is bad (code word for stupid) I suppose it can get worse (polite way of saying stupider): I've a domain name ending in .info - which is rejected as invalid by a number of places. I didn't test to see what top level domains they think are real - but, well, as we well know: There's no limit to or cure for stupid.

                                          Ravings en masse^

                                          "The difference between genius and stupidity is that genius has its limits." - Albert Einstein

                                          "If you are searching for perfection in others, then you seek disappointment. If you are seek perfection in yourself, then you will find failure." - Balboos HaGadol Mar 2010

                                          OriginalGriffO Offline
                                          OriginalGriffO Offline
                                          OriginalGriff
                                          wrote on last edited by
                                          #44

                                          Too long - everybody knows that ".com" is only three letters... :laugh:

                                          Bad command or file name. Bad, bad command! Sit! Stay! Staaaay...

                                          "I have no idea what I did, but I'm taking full credit for it." - ThisOldTony
                                          "Common sense is so rare these days, it should be classified as a super power" - Random T-shirt

                                          1 Reply Last reply
                                          0
                                          Reply
                                          • Reply as topic
                                          Log in to reply
                                          • Oldest to Newest
                                          • Newest to Oldest
                                          • Most Votes


                                          • Login

                                          • Don't have an account? Register

                                          • Login or register to search.
                                          • First post
                                            Last post
                                          0
                                          • Categories
                                          • Recent
                                          • Tags
                                          • Popular
                                          • World
                                          • Users
                                          • Groups